PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn347371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 427aa    MW: 48429.6 Da    PI: 7.9719
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn347371genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.71.7e-172075257
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                +kR+  t++q+e+Le+++ +++yps+e + + A+++gLte+qV+ WF+ rR k+k+
  Achn347371 20 KKRRLKTPSQVEALEKFYFEHKYPSEELKSQFAESVGLTEKQVSGWFCHRRLKDKR 75
                7999**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-18675IPR009057Homeodomain-like
SuperFamilySSF466892.48E-161476IPR009057Homeodomain-like
PROSITE profilePS5007116.4061676IPR001356Homeobox domain
SMARTSM003893.5E-151880IPR001356Homeobox domain
PfamPF000464.3E-152075IPR001356Homeobox domain
CDDcd000861.12E-152076No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MLESCEVHSE DSKALPAKYK KRRLKTPSQV EALEKFYFEH KYPSEELKSQ FAESVGLTEK  60
QVSGWFCHRR LKDKRSLYVE VSANGRQDRS SGIIQDRGSG LKQDSCGSTK QGNNRHDPRE  120
VESRRFSGRD FSVANLAYDH DRHHNRNYND MDDTSSGSSL LLQRNFLRQS ENHFDVVTSR  180
YLPKNENIEQ INLMGIRTRI GPSGYLKVKG KVENAAVTAV KRQLGRHYRE DGPQLGVEFD  240
SLPPGAFESS TREPDNEPHF LGDASPLYST DVPGIHNKSN SCTRYEAYNS KMSLHNSDLD  300
GTSFKIMHGS DHHENSMGHR SKPMRLLPNH GNPFPGWKSS LDRNEISTGE ISVYDGSRLY  360
KMRAKHDVEG GSRMDYVSSC HMPPHDRKVT GKHREPWLCK SDDVSLADAQ IEHLEAENSN  420
KTLEYG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11924KKRRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279963.21e-134PREDICTED: uncharacterized protein LOC100265339
TrEMBLF6HA211e-134F6HA21_VITVI; Putative uncharacterized protein
STRINGVIT_06s0009g03530.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34362242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.16e-74HB-other family protein